(data stored in ACNUC7421 zone)

EMBL: CP001022.PE164

CP001022.PE164       Location/Qualifiers
FT   CDS             181863..183224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi04170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59652"
FT                   /db_xref="GOA:B1YHC0"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC0"
FT                   /protein_id="ACB59652.1"
FT                   /translation="MSKHDLQKEYDQIPVPQAALQERIRQGIKQGKREQQIKRPKRLRR
FT                   LVVSTGLAASLLITSTFVIPSFATAMAKVPLLGQMYRPFLEQENTGTAIGQKQLATTIH
FT                   QVASDQGIDIQVIDAYYDGATIGMNLIATVVPDVKPEIRSGLYELFKGDQRFAGTETKE
FT                   VVQFKQVKGIWQARIEYTLGEIKLQDKIQIPVVLTDVFGVHGNWTFNVPVKRLPVTEQV
FT                   YGTTVKNPIYRTDITLNRLIQGKGSTSFDYTTRSPKKERARVEMTLLDQFGKEIIRNWT
FT                   WSTQSVKRTKTATEAVEQSRLILGNYVIPKGSYLLQPSLRIDLKTQPIPLTKPLPYREQ
FT                   SETHPLKMEITSIETTSEQVVVEFSTNSRSSQFDTKLDIRNSMYLLKGTEPPDGREIKA
FT                   KVTVLDADKQTFRATFQLPEPSEHTREEYYLETGYSNTLVNTPLELQPIPFTVD"
     MSKHDLQKEY DQIPVPQAAL QERIRQGIKQ GKREQQIKRP KRLRRLVVST GLAASLLITS        60
     TFVIPSFATA MAKVPLLGQM YRPFLEQENT GTAIGQKQLA TTIHQVASDQ GIDIQVIDAY       120
     YDGATIGMNL IATVVPDVKP EIRSGLYELF KGDQRFAGTE TKEVVQFKQV KGIWQARIEY       180
     TLGEIKLQDK IQIPVVLTDV FGVHGNWTFN VPVKRLPVTE QVYGTTVKNP IYRTDITLNR       240
     LIQGKGSTSF DYTTRSPKKE RARVEMTLLD QFGKEIIRNW TWSTQSVKRT KTATEAVEQS       300
     RLILGNYVIP KGSYLLQPSL RIDLKTQPIP LTKPLPYREQ SETHPLKMEI TSIETTSEQV       360
     VVEFSTNSRS SQFDTKLDIR NSMYLLKGTE PPDGREIKAK VTVLDADKQT FRATFQLPEP       420
     SEHTREEYYL ETGYSNTLVN TPLELQPIPF TVD                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page