(data stored in ACNUC7421 zone)

EMBL: CP001022.PE171

CP001022.PE171       Location/Qualifiers
FT   CDS             189782..190627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0173"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rba:RB133 predicted
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59659"
FT                   /db_xref="GOA:B1YHC7"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC7"
FT                   /protein_id="ACB59659.1"
FT                   /translation="MKWKGRERSSNVEDRRGMGGKGVAGIGGGLGIIILIVVTLMGGNP
FT                   ADILGGLSDSQGDSQGEYQETAKEKEAADFVSVVLADTEKVWTKEFKQDGMTYKEPTLV
FT                   LYTDQVSSACGQAGKSVGPFYCPGDQKLYIDLSFYDELQNKYGAPGDFAMAYVIAHEVG
FT                   HHVQTLLGTSDEIMPLRQKMSEEKFNKYLVRFELQADYYAGVWANHAQGQNLLEEGDLE
FT                   EALGAANAVGDDTLQKKGQGYVVPESFTHGTSAQRERWFQKGFDNGTIEGGDTFKAKNL
FT                   "
     MKWKGRERSS NVEDRRGMGG KGVAGIGGGL GIIILIVVTL MGGNPADILG GLSDSQGDSQ        60
     GEYQETAKEK EAADFVSVVL ADTEKVWTKE FKQDGMTYKE PTLVLYTDQV SSACGQAGKS       120
     VGPFYCPGDQ KLYIDLSFYD ELQNKYGAPG DFAMAYVIAH EVGHHVQTLL GTSDEIMPLR       180
     QKMSEEKFNK YLVRFELQAD YYAGVWANHA QGQNLLEEGD LEEALGAANA VGDDTLQKKG       240
     QGYVVPESFT HGTSAQRERW FQKGFDNGTI EGGDTFKAKN L                           281
//

If you have problems or comments...

PBIL Back to PBIL home page