(data stored in ACNUC7421 zone)

EMBL: CP001022.PE172

CP001022.PE172       Location/Qualifiers
FT   CDS             complement(190676..191068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59660"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:3ER7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC8"
FT                   /protein_id="ACB59660.1"
FT                   /translation="MMNTTTLDRYFDLFDASRTDEKAFDDLISLFSDEITFVLNGQEQH
FT                   GIDAWKQFVRMVFTANQDIKHMYAGWVPSETGDTMETRWAVCGKSADGSVFTQDGTDIA
FT                   RLNADGKIVYLANVPDDTAMFNQYND"
     MMNTTTLDRY FDLFDASRTD EKAFDDLISL FSDEITFVLN GQEQHGIDAW KQFVRMVFTA        60
     NQDIKHMYAG WVPSETGDTM ETRWAVCGKS ADGSVFTQDG TDIARLNADG KIVYLANVPD       120
     DTAMFNQYND                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page