(data stored in ACNUC7421 zone)

EMBL: CP001022.PE175

CP001022.PE175       Location/Qualifiers
FT   CDS             193501..195219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0177"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="KEGG: bha:BH3972 ABC transporter required for
FT                   expression of cytochrome bd (ATP-binding protein); TIGRFAM:
FT                   ABC transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59663"
FT                   /db_xref="GOA:B1YHD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD1"
FT                   /protein_id="ACB59663.1"
FT                   /translation="MKELMGIFRLMLHQKRDIVLSIIFGVLAGITAVGMFAASGFLISK
FT                   AALLPPIQTLAVLIALQKISSLTRAVSRYAERYYSHRATFTILSDLRTTFYKRLEPLAP
FT                   GIFAKYRSGDLLARIVGDVESLQNTFLRVVYPPIILVLVFLCTIFFVSFFSLSVALVLV
FT                   FGLILTGFIIPGWFAYREQRFARSVRARRGELSTEVTELFQGYRDLKIYQQLGNKEAEL
FT                   NAVAARYVAEEKRNGLHAVSNLALNTLATLVISWIVLGLGAYLVADGQLDGVFLALLVM
FT                   TSLTVFENAAPMAILPGFFEDSRHAARRLDDVVEATAEPEYRPFALTQAPELRAEHVSF
FT                   TFPGQDRPVLRDVSVTFPAGSKTAIVGASGSGKSTLLQLLLRMYPADGIRIEGTPGLEI
FT                   NPEALWQQSNVVLQQNHFFYGTIRDNLKLASSKATDEQMIEALEHVGLSLLELDDRVLE
FT                   KGENLSGGEKQRLAIARIFLRQTPLYLLDEPTSSVDALTEQMILRHLFSRAVDATLLLV
FT                   SHRLAGLETMDQIVVMEQGQVVEVGTYADLMTKQGAFYALKQVEQSVFTPDQLVR"
     MKELMGIFRL MLHQKRDIVL SIIFGVLAGI TAVGMFAASG FLISKAALLP PIQTLAVLIA        60
     LQKISSLTRA VSRYAERYYS HRATFTILSD LRTTFYKRLE PLAPGIFAKY RSGDLLARIV       120
     GDVESLQNTF LRVVYPPIIL VLVFLCTIFF VSFFSLSVAL VLVFGLILTG FIIPGWFAYR       180
     EQRFARSVRA RRGELSTEVT ELFQGYRDLK IYQQLGNKEA ELNAVAARYV AEEKRNGLHA       240
     VSNLALNTLA TLVISWIVLG LGAYLVADGQ LDGVFLALLV MTSLTVFENA APMAILPGFF       300
     EDSRHAARRL DDVVEATAEP EYRPFALTQA PELRAEHVSF TFPGQDRPVL RDVSVTFPAG       360
     SKTAIVGASG SGKSTLLQLL LRMYPADGIR IEGTPGLEIN PEALWQQSNV VLQQNHFFYG       420
     TIRDNLKLAS SKATDEQMIE ALEHVGLSLL ELDDRVLEKG ENLSGGEKQR LAIARIFLRQ       480
     TPLYLLDEPT SSVDALTEQM ILRHLFSRAV DATLLLVSHR LAGLETMDQI VVMEQGQVVE       540
     VGTYADLMTK QGAFYALKQV EQSVFTPDQL VR                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page