(data stored in ACNUC7421 zone)

EMBL: CP001022.PE176

CP001022.PE176       Location/Qualifiers
FT   CDS             195341..195994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_2830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59664"
FT                   /db_xref="InterPro:IPR017018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD2"
FT                   /protein_id="ACB59664.1"
FT                   /translation="MMEILRCETQLEDQTIAYNHYYSDSDEICFMLSGAGYAYDHPYFY
FT                   FSRMMLLKRKVNVIEIQYVSDDLFSMPDEQGDAEMSRRIEAVIGDVLRARSYQTIHFIA
FT                   KSLGTVPLVSMMHRGMFPEARVVLLTPLLKDPAIVEKIANSRHHGLLIIGDQDRQYSPE
FT                   ALERFSNSNLVLELVTGANHSLDIDFDVKPSLQVLGQIMQRIEDVLFTVTVKEN"
     MMEILRCETQ LEDQTIAYNH YYSDSDEICF MLSGAGYAYD HPYFYFSRMM LLKRKVNVIE        60
     IQYVSDDLFS MPDEQGDAEM SRRIEAVIGD VLRARSYQTI HFIAKSLGTV PLVSMMHRGM       120
     FPEARVVLLT PLLKDPAIVE KIANSRHHGL LIIGDQDRQY SPEALERFSN SNLVLELVTG       180
     ANHSLDIDFD VKPSLQVLGQ IMQRIEDVLF TVTVKEN                                217
//

If you have problems or comments...

PBIL Back to PBIL home page