(data stored in ACNUC7421 zone)

EMBL: CP001022.PE18

CP001022.PE18        Location/Qualifiers
FT   CDS             28276..28596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bwe:BcerKBAB4_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59506"
FT                   /db_xref="GOA:B1YGC9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGC9"
FT                   /protein_id="ACB59506.1"
FT                   /translation="MRGMGNMNNMMKQMQKMQKDMAKAQEELKDLTVTGTAGGEMVSVV
FT                   ADGHKNIIDVIIKEEVVDPDDVEMIQDLVLAATNDALKKVDELVSSKMGKFTQGMNMPG
FT                   MF"
     MRGMGNMNNM MKQMQKMQKD MAKAQEELKD LTVTGTAGGE MVSVVADGHK NIIDVIIKEE        60
     VVDPDDVEMI QDLVLAATND ALKKVDELVS SKMGKFTQGM NMPGMF                      106
//

If you have problems or comments...

PBIL Back to PBIL home page