(data stored in ACNUC7421 zone)

EMBL: CP001022.PE183

CP001022.PE183       Location/Qualifiers
FT   CDS             201530..201862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59671"
FT                   /db_xref="GOA:B1YHD9"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD9"
FT                   /protein_id="ACB59671.1"
FT                   /translation="MRYTYWAALIGLIISMYLLVDYTVETVPVSILIGLLIYSIGLSIV
FT                   ATFEVSSFELTRRAFVTTLLFGLVLNHVLDLRMTAFLLVLLVVETLVKTLRFLQVLWWD
FT                   RATLHG"
     MRYTYWAALI GLIISMYLLV DYTVETVPVS ILIGLLIYSI GLSIVATFEV SSFELTRRAF        60
     VTTLLFGLVL NHVLDLRMTA FLLVLLVVET LVKTLRFLQV LWWDRATLHG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page