(data stored in ACNUC7421 zone)

EMBL: CP001022.PE186

CP001022.PE186       Location/Qualifiers
FT   CDS             complement(204400..206148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0188"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lpl:lp_1819 teichoic acid
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59674"
FT                   /db_xref="GOA:B1YHE2"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE2"
FT                   /protein_id="ACB59674.1"
FT                   /translation="MPTLQAHVNYLELAGTKFRFEARLFGLTDFIQAEQLLFENPAAPE
FT                   DTEETQPDDGYIQSEAPAEPIPLERAVIFRNKRNKRTFILRFPFEGDWTEETFSGELDL
FT                   NHLTPTGRPLPMGYFDAFFAIVQGKSILHEAPFGDTRSLIPVIYRVDTKHSNVLLKLEY
FT                   ELVVQYSEYSNTLGFHSLKQGETKRFIRLIEKFNKSKKNWRKRAFKFRRFTFKSIYNVT
FT                   KWTQPIQDNKVVFASDSRSDVSGNFAYILNEIERRDLNLDVKTFFKPNLQSRRDWRDKF
FT                   TLPYHLATAKTILVDDFYPMIYPLNIRKGSDLVQVWHAVGAFKTFGYSRLGKPGGPSAN
FT                   SLSHRNYTKAIVSSHNVARHYAEGFGLREDQVIATGIPRTDMFFDQTYIAEAKERIYEE
FT                   YPVFKTKKVIMFAPTFRGNGAKSAHYDFSQLDLDALYEAFHEDYVFVLKMHPFVRRRME
FT                   IPEVYADFFLDLTDYREINELLFVSDILITDYSSTCFEFSLLDRPMLFFAYDLEDYISK
FT                   RDFYYDFEEFVPGPIVRTSEELIERIKNEDFEMQNVKAFAEYFFEHQDGKSSQRFVDQI
FT                   ILGEDK"
     MPTLQAHVNY LELAGTKFRF EARLFGLTDF IQAEQLLFEN PAAPEDTEET QPDDGYIQSE        60
     APAEPIPLER AVIFRNKRNK RTFILRFPFE GDWTEETFSG ELDLNHLTPT GRPLPMGYFD       120
     AFFAIVQGKS ILHEAPFGDT RSLIPVIYRV DTKHSNVLLK LEYELVVQYS EYSNTLGFHS       180
     LKQGETKRFI RLIEKFNKSK KNWRKRAFKF RRFTFKSIYN VTKWTQPIQD NKVVFASDSR       240
     SDVSGNFAYI LNEIERRDLN LDVKTFFKPN LQSRRDWRDK FTLPYHLATA KTILVDDFYP       300
     MIYPLNIRKG SDLVQVWHAV GAFKTFGYSR LGKPGGPSAN SLSHRNYTKA IVSSHNVARH       360
     YAEGFGLRED QVIATGIPRT DMFFDQTYIA EAKERIYEEY PVFKTKKVIM FAPTFRGNGA       420
     KSAHYDFSQL DLDALYEAFH EDYVFVLKMH PFVRRRMEIP EVYADFFLDL TDYREINELL       480
     FVSDILITDY SSTCFEFSLL DRPMLFFAYD LEDYISKRDF YYDFEEFVPG PIVRTSEELI       540
     ERIKNEDFEM QNVKAFAEYF FEHQDGKSSQ RFVDQIILGE DK                          582
//

If you have problems or comments...

PBIL Back to PBIL home page