(data stored in ACNUC7421 zone)

EMBL: CP001022.PE19

CP001022.PE19        Location/Qualifiers
FT   CDS             28615..29214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0020"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bwe:BcerKBAB4_0020 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59507"
FT                   /db_xref="GOA:B1YGD0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGD0"
FT                   /protein_id="ACB59507.1"
FT                   /translation="MQYPEAISRLIESFTKLPGIGPKTAVRLAFHVLDMEEDDVLMFGK
FT                   ALVSAKRDISYCSICGNITDKDPCYVCSDKHRNRTIVCVVQDSRDVIAMEKMRDYQGLY
FT                   HVLHGAISPMEGIGPEDINVSSLLTRLQADEAITEIILATNPNIEGEATAMYLSRLLKP
FT                   TGIRVTRIAHGLPVGGDLEYADEVTLSRAMEGRREL"
     MQYPEAISRL IESFTKLPGI GPKTAVRLAF HVLDMEEDDV LMFGKALVSA KRDISYCSIC        60
     GNITDKDPCY VCSDKHRNRT IVCVVQDSRD VIAMEKMRDY QGLYHVLHGA ISPMEGIGPE       120
     DINVSSLLTR LQADEAITEI ILATNPNIEG EATAMYLSRL LKPTGIRVTR IAHGLPVGGD       180
     LEYADEVTLS RAMEGRREL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page