(data stored in ACNUC7421 zone)

EMBL: CP001022.PE191

CP001022.PE191       Location/Qualifiers
FT   CDS             complement(209651..210208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0193"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bsu:BSU08480
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59679"
FT                   /db_xref="GOA:B1YHE7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE7"
FT                   /protein_id="ACB59679.1"
FT                   /translation="MNTRQLILERRSVRAYTDQPVPNEMIEEILEAAIYAPTHKLREPW
FT                   RFVLVNEESQERYVDQLMTLLAKRGQLDQKTDEQRQMMRQKFADVPVYLTVLYEVKGTE
FT                   DQQMEDLLATAAMIQNVQLLATELGLGCCWKSGKHWFTEEYAEMIGASENERVAGIIQF
FT                   GWPALIPPLKKRTAARDKLTHF"
     MNTRQLILER RSVRAYTDQP VPNEMIEEIL EAAIYAPTHK LREPWRFVLV NEESQERYVD        60
     QLMTLLAKRG QLDQKTDEQR QMMRQKFADV PVYLTVLYEV KGTEDQQMED LLATAAMIQN       120
     VQLLATELGL GCCWKSGKHW FTEEYAEMIG ASENERVAGI IQFGWPALIP PLKKRTAARD       180
     KLTHF                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page