(data stored in ACNUC7421 zone)

EMBL: CP001022.PE192

CP001022.PE192       Location/Qualifiers
FT   CDS             complement(210298..210834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090038000415 predicted protein Pfam: TRP
FT                   E1_DerP2_DerF2 COX1 DUF221 7TMR-DISM_7TM BofA COPI_assoc"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59680"
FT                   /db_xref="GOA:B1YHE8"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE8"
FT                   /protein_id="ACB59680.1"
FT                   /translation="MVAFLQFYAFIFACCFAWQVGRPSSWSQKVTRAFLISINSLFIFF
FT                   RASVSIFLLIGPLLLVSYVLFPHLLYFAGPLSIIISILVIGLLDRLVSFVILPIIRSFF
FT                   LKKNRMMPQLLEAVLYTFSMGVLLFANLTVVPGVQINIMIAVFFGFTLYFAHYLFALFR
FT                   IRQLKKKIAASPDKR"
     MVAFLQFYAF IFACCFAWQV GRPSSWSQKV TRAFLISINS LFIFFRASVS IFLLIGPLLL        60
     VSYVLFPHLL YFAGPLSIII SILVIGLLDR LVSFVILPII RSFFLKKNRM MPQLLEAVLY       120
     TFSMGVLLFA NLTVVPGVQI NIMIAVFFGF TLYFAHYLFA LFRIRQLKKK IAASPDKR         178
//

If you have problems or comments...

PBIL Back to PBIL home page