(data stored in ACNUC7421 zone)

EMBL: CP001022.PE197

CP001022.PE197       Location/Qualifiers
FT   CDS             complement(215468..215917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0199"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: btl:BALH_1242
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59685"
FT                   /db_xref="GOA:B1YHF3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF3"
FT                   /protein_id="ACB59685.1"
FT                   /translation="MPQERDQLTYRLEEQMRIILRTLRRELNRLFEGTATRSEFFILRS
FT                   LSENGPQRPTLLAEQFELATSQVTALTDRLYKAGFVTRTRSTDDRRSIVLALTEEGESA
FT                   FRELEIVRRKYLQDRFGTLTEEELNAMVLVFDKILLTMDEEAISS"
     MPQERDQLTY RLEEQMRIIL RTLRRELNRL FEGTATRSEF FILRSLSENG PQRPTLLAEQ        60
     FELATSQVTA LTDRLYKAGF VTRTRSTDDR RSIVLALTEE GESAFRELEI VRRKYLQDRF       120
     GTLTEEELNA MVLVFDKILL TMDEEAISS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page