(data stored in ACNUC7421 zone)

EMBL: CP001022.PE198

CP001022.PE198       Location/Qualifiers
FT   CDS             216251..217882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0200"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   esa:ESA_01082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59686"
FT                   /db_xref="GOA:B1YHF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF4"
FT                   /protein_id="ACB59686.1"
FT                   /translation="MTCGELSFTTVEWGASFYYVAFSSSFWKVRALFVFSKSVLSKNLN
FT                   KREANEMNTLQPQRKLDSTEEGLKRGLQARHMSMIAIGGAIGTGLFIASGASVAAAGPG
FT                   GALLSYAIVGLMVYFLMTSLGEMAAYMPVAGSFSTYGAKFVDPSFGFALGWNYWYNWAV
FT                   TIAVELVAAQIVMSYWFPDVPGFYFSALFLLLMIGLNYFSVKGFGEAEYWFAMIKVVTV
FT                   IIFLIVGVAMIFGVFTSEAPVGFKNFALGDAPFVGGIPAVIGIILVAGFSFQGTELVGI
FT                   AAGESEDPKKNVPKAVKQVFWRILLFYVFAIFVIGMLIPYTSPNLVSNDITDVAVSPFT
FT                   LVFEKAGLAFSAALMNAVILTSVLSAGNSGMYASTRMLYTLARQGDAPKLFAQVSKNGV
FT                   PRNALLATGAIGALCFLTSMFGGQVYLWLLNASGMTGFIAWLGIAISHYRFRKGFLAQG
FT                   HSLSDLPYVAPAFPFGPLFAFGLCFLVIVGQNYAAFLADQIDWVGIAATYVGIPLFLAF
FT                   WLGHKFKNRTSVVPYEEMEFPEHPRP"
     MTCGELSFTT VEWGASFYYV AFSSSFWKVR ALFVFSKSVL SKNLNKREAN EMNTLQPQRK        60
     LDSTEEGLKR GLQARHMSMI AIGGAIGTGL FIASGASVAA AGPGGALLSY AIVGLMVYFL       120
     MTSLGEMAAY MPVAGSFSTY GAKFVDPSFG FALGWNYWYN WAVTIAVELV AAQIVMSYWF       180
     PDVPGFYFSA LFLLLMIGLN YFSVKGFGEA EYWFAMIKVV TVIIFLIVGV AMIFGVFTSE       240
     APVGFKNFAL GDAPFVGGIP AVIGIILVAG FSFQGTELVG IAAGESEDPK KNVPKAVKQV       300
     FWRILLFYVF AIFVIGMLIP YTSPNLVSND ITDVAVSPFT LVFEKAGLAF SAALMNAVIL       360
     TSVLSAGNSG MYASTRMLYT LARQGDAPKL FAQVSKNGVP RNALLATGAI GALCFLTSMF       420
     GGQVYLWLLN ASGMTGFIAW LGIAISHYRF RKGFLAQGHS LSDLPYVAPA FPFGPLFAFG       480
     LCFLVIVGQN YAAFLADQID WVGIAATYVG IPLFLAFWLG HKFKNRTSVV PYEEMEFPEH       540
     PRP                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page