(data stored in ACNUC7421 zone)

EMBL: CP001022.PE20

CP001022.PE20        Location/Qualifiers
FT   CDS             29211..29435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59508"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD1"
FT                   /protein_id="ACB59508.1"
FT                   /translation="MNWFRKKIRSEYDERFLRELALAQENYLMKRRLLEISYDDCGDLE
FT                   AQMKLAESVYYFYIREAKKRRVSLPTVRL"
     MNWFRKKIRS EYDERFLREL ALAQENYLMK RRLLEISYDD CGDLEAQMKL AESVYYFYIR        60
     EAKKRRVSLP TVRL                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page