(data stored in ACNUC7421 zone)

EMBL: CP001022.PE200

CP001022.PE200       Location/Qualifiers
FT   CDS             218262..219209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0202"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A; Methionine sulfoxide reductase B;
FT                   KEGG: bcy:Bcer98_3954 methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59688"
FT                   /db_xref="GOA:B1YHF6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF6"
FT                   /protein_id="ACB59688.1"
FT                   /translation="MAKAIFAGGCFWCMVKPFHKYDGVEQVISGYTGGHTENPTYKEVC
FT                   SETTGHLEAVEVTYDPSVITYDELLEIFWRQIDPTDGGGQFNDRGQSYEPAIFYVDEDQ
FT                   KQAAERSKAALDASGRFSKPVAVDIRPAKPFWPAEEYHQDYYKKNPFRYQMYSVGSGRA
FT                   KFVKEAWKDQGKEQELKQRLTPIQYKVTQENGTEPAFRNEYWDEERPGLYVDIVDGTPL
FT                   FTSKDKFNSNCGWPSFAKPISEDKMEVELDTSHGMTRTEVRSANADSHLGHIFDDGPTE
FT                   LGGLRYCINSAALRFIPVEELDSAGYGEYKKHFE"
     MAKAIFAGGC FWCMVKPFHK YDGVEQVISG YTGGHTENPT YKEVCSETTG HLEAVEVTYD        60
     PSVITYDELL EIFWRQIDPT DGGGQFNDRG QSYEPAIFYV DEDQKQAAER SKAALDASGR       120
     FSKPVAVDIR PAKPFWPAEE YHQDYYKKNP FRYQMYSVGS GRAKFVKEAW KDQGKEQELK       180
     QRLTPIQYKV TQENGTEPAF RNEYWDEERP GLYVDIVDGT PLFTSKDKFN SNCGWPSFAK       240
     PISEDKMEVE LDTSHGMTRT EVRSANADSH LGHIFDDGPT ELGGLRYCIN SAALRFIPVE       300
     ELDSAGYGEY KKHFE                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page