(data stored in ACNUC7421 zone)

EMBL: CP001022.PE204

CP001022.PE204       Location/Qualifiers
FT   CDS             complement(223972..224940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0206"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   csa:Csal_2663 oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59692"
FT                   /db_xref="GOA:B1YHG0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG0"
FT                   /protein_id="ACB59692.1"
FT                   /translation="MIRTALIGFGLAGEHLHAPYLTAPDYQLVAVQSSRPEAVATRYPD
FT                   VPVYSSLEELLAAETIELVVIATPNAEHYPLAKTALSAGCHVLVEKPFTVTLLEAEQLT
FT                   DLARQQNRLLTVYHNRRYTKDFRTLLELVQADELGVVQTFEAHYDRYRPTVRARWREQD
FT                   VPGAGLLYDLGSHLIDQALMLFSERPDRVFCDQTIQRPDGPVEDYTHLILAFGTRRAIL
FT                   HIGSLVPAPGPSLAVHGTKASYFVDSVDTKRSTYTWGRPEQPLEERPFVDSGFADYYHD
FT                   LAHALRHESPLTVTTEQALLVMKIIDCAQKSVKEGTWIEVD"
     MIRTALIGFG LAGEHLHAPY LTAPDYQLVA VQSSRPEAVA TRYPDVPVYS SLEELLAAET        60
     IELVVIATPN AEHYPLAKTA LSAGCHVLVE KPFTVTLLEA EQLTDLARQQ NRLLTVYHNR       120
     RYTKDFRTLL ELVQADELGV VQTFEAHYDR YRPTVRARWR EQDVPGAGLL YDLGSHLIDQ       180
     ALMLFSERPD RVFCDQTIQR PDGPVEDYTH LILAFGTRRA ILHIGSLVPA PGPSLAVHGT       240
     KASYFVDSVD TKRSTYTWGR PEQPLEERPF VDSGFADYYH DLAHALRHES PLTVTTEQAL       300
     LVMKIIDCAQ KSVKEGTWIE VD                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page