(data stored in ACNUC7421 zone)

EMBL: CP001022.PE208

CP001022.PE208       Location/Qualifiers
FT   CDS             complement(226911..227882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0210"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: lwe:lwe1715
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59696"
FT                   /db_xref="GOA:B1YHG4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG4"
FT                   /protein_id="ACB59696.1"
FT                   /translation="MSNFFTLLRRGNKSALAAAIVNTVIALIKFVAYILTGNIAMFAEM
FT                   MHTIGDAANQFFVYVGSALSKKAPTKRFPNGFGRLVNLVLLAAILVVAILAYETIREGV
FT                   LHILHAPGEKTSGLWIILTALGIGVVLEVGVFYKAMTEIAHETGLKSRGLTLVGQSFAN
FT                   LSQAKPATRLVFMEDLVATLGGVIAIIAVLISHYTSFYQAEGIASILIGLMMFYVVYNV
FT                   FIQNAAGALGEIDEVLTAKIGEILMRDPDVRDIEKLEVIKEGDHFHVEIEIEVDPGLTI
FT                   AQADDIKDRLELQIRILKGITDVTISFDEDDKIQHYQPPTQP"
     MSNFFTLLRR GNKSALAAAI VNTVIALIKF VAYILTGNIA MFAEMMHTIG DAANQFFVYV        60
     GSALSKKAPT KRFPNGFGRL VNLVLLAAIL VVAILAYETI REGVLHILHA PGEKTSGLWI       120
     ILTALGIGVV LEVGVFYKAM TEIAHETGLK SRGLTLVGQS FANLSQAKPA TRLVFMEDLV       180
     ATLGGVIAII AVLISHYTSF YQAEGIASIL IGLMMFYVVY NVFIQNAAGA LGEIDEVLTA       240
     KIGEILMRDP DVRDIEKLEV IKEGDHFHVE IEIEVDPGLT IAQADDIKDR LELQIRILKG       300
     ITDVTISFDE DDKIQHYQPP TQP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page