(data stored in ACNUC7421 zone)

EMBL: CP001022.PE21

CP001022.PE21        Location/Qualifiers
FT   CDS             40787..42196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0022"
FT                   /product="Arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region; KEGG:
FT                   gtn:GTNG_0022 lysine decarboxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59509"
FT                   /db_xref="GOA:B1YGD2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD2"
FT                   /protein_id="ACB59509.1"
FT                   /translation="MPIIEALCAHVERNATSWHVPGHKNGTLFEGLPSFFEWDKTELRG
FT                   LDDFHYPEEAIYEAKLLLRQVYEARDSHFLINGSTVGNWAMLAAVSQRGDRIYVQRNSH
FT                   KSVFNALEWLGLSPILLGPEIDPSTGISGNVSRETLEEALTTFPGGVAVFLTSPTYYGE
FT                   TARIEELLPFTTASGIPLLIDEAHGAHFGEAFGVRSAFELGATAVVQSAHKTLPALTMG
FT                   AWIHERFTDDERRRLTRALQAFQTSSPSYLLMASLDFAREYREKWTVSNMKSVRTSHEH
FT                   LHQQINQLTDITAFTFDDWSRMILSCEEYSGSQLIEALADQGLDAEFALGPHVVCILPL
FT                   RSIEPFEQDTWINQIQLAIETLKAEGIPDKRYMEQPFMGKIKVSSLACPLDQLEDAEAV
FT                   EQTFEQSVGLVSLETIIPYPPGIPLILRGERITAEHITMIEHYINTSIHLQGGEFLHQG
FT                   KLRVIQEGIRE"
     MPIIEALCAH VERNATSWHV PGHKNGTLFE GLPSFFEWDK TELRGLDDFH YPEEAIYEAK        60
     LLLRQVYEAR DSHFLINGST VGNWAMLAAV SQRGDRIYVQ RNSHKSVFNA LEWLGLSPIL       120
     LGPEIDPSTG ISGNVSRETL EEALTTFPGG VAVFLTSPTY YGETARIEEL LPFTTASGIP       180
     LLIDEAHGAH FGEAFGVRSA FELGATAVVQ SAHKTLPALT MGAWIHERFT DDERRRLTRA       240
     LQAFQTSSPS YLLMASLDFA REYREKWTVS NMKSVRTSHE HLHQQINQLT DITAFTFDDW       300
     SRMILSCEEY SGSQLIEALA DQGLDAEFAL GPHVVCILPL RSIEPFEQDT WINQIQLAIE       360
     TLKAEGIPDK RYMEQPFMGK IKVSSLACPL DQLEDAEAVE QTFEQSVGLV SLETIIPYPP       420
     GIPLILRGER ITAEHITMIE HYINTSIHLQ GGEFLHQGKL RVIQEGIRE                   469
//

If you have problems or comments...

PBIL Back to PBIL home page