(data stored in ACNUC7421 zone)

EMBL: CP001022.PE212

CP001022.PE212       Location/Qualifiers
FT   CDS             231509..232120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0214"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   gtn:GTNG_1178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59700"
FT                   /db_xref="GOA:B1YHG8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG8"
FT                   /protein_id="ACB59700.1"
FT                   /translation="MSWDLLNIIGTVAFAMSGAIVAMEEKYDLFGVWLLALITAFGGGA
FT                   IRNLLIGVPVSALWSQGGLFLIAILVALLIFILPQLFLPHWTRWGVLADALGLSAFAIQ
FT                   GALMASAKGLPLSATISAAVLTGVGGGVIRDLLAGRKPLVLHKEIYAMWAVMAALVIDR
FT                   FELTNPLHLFTLLGLITILRMLSYYYEWNLPARRLGGDKE"
     MSWDLLNIIG TVAFAMSGAI VAMEEKYDLF GVWLLALITA FGGGAIRNLL IGVPVSALWS        60
     QGGLFLIAIL VALLIFILPQ LFLPHWTRWG VLADALGLSA FAIQGALMAS AKGLPLSATI       120
     SAAVLTGVGG GVIRDLLAGR KPLVLHKEIY AMWAVMAALV IDRFELTNPL HLFTLLGLIT       180
     ILRMLSYYYE WNLPARRLGG DKE                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page