(data stored in ACNUC7421 zone)

EMBL: CP001022.PE22

CP001022.PE22        Location/Qualifiers
FT   CDS             42193..42831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0023"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: aoe:Clos_0060 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59510"
FT                   /db_xref="GOA:B1YGD3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGD3"
FT                   /protein_id="ACB59510.1"
FT                   /translation="MTGTFITVEGPDGAGKTTQLQLLADRLTAEGYEIVMTREPGGTRI
FT                   GNEIRSLILNPDFQEMDEMTEILLYAASRAQHVNELIRPALAAGKIVLCDRFIDASIAY
FT                   QGYGLGYTIEQVRSINQQATNHLTPDRTYLFDLTVSESKQRMMDRGALDRIEQRDDAFR
FT                   QRVYDGFMTLAVQEPERIQLVDANQSIESLQTELCKDVLTYLKKRERLS"
     MTGTFITVEG PDGAGKTTQL QLLADRLTAE GYEIVMTREP GGTRIGNEIR SLILNPDFQE        60
     MDEMTEILLY AASRAQHVNE LIRPALAAGK IVLCDRFIDA SIAYQGYGLG YTIEQVRSIN       120
     QQATNHLTPD RTYLFDLTVS ESKQRMMDRG ALDRIEQRDD AFRQRVYDGF MTLAVQEPER       180
     IQLVDANQSI ESLQTELCKD VLTYLKKRER LS                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page