(data stored in ACNUC7421 zone)

EMBL: CP001022.PE221

CP001022.PE221       Location/Qualifiers
FT   CDS             239226..241205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0223"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   bsu:BSU31260 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59709"
FT                   /db_xref="GOA:B1YHS5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS5"
FT                   /protein_id="ACB59709.1"
FT                   /translation="MEQKKKRTLSIKQKLILTSMLLLLIPSLLIGFVSYSQAKQKIMNE
FT                   ILQSAHAGVDRMNDEIMNIIDPMRRDVAFFADRIDGTLYQSGKQNLDLKEKMTEYLDTH
FT                   PQAANIYYATTSGEMTIYPEQSMPDDYDPRERPWYKAAEDASGKVVITDPYVDAASGKM
FT                   MVTLSQTGGNGRGVIAIDVDVDRIADIAKKIKIGKEGYVTILDSKKNFVTHPTLKPGET
FT                   ATGNWVGPLYAGKEGRFSYLFEDEDKQMDFMTNGLTGWKVAGTLYDREITDETASILWT
FT                   TLGVIAGTFLLAGLLLFFILRSIISPLNRLTKSAERIQEGDLTEEVVVESNDEIGKVAE
FT                   SFNTMILSLRGIISNLDQSIGQVAASSEELMANAAQTTAASEQIAGSIQEMAAGAGQSK
FT                   RQLDGNAVSLQAITSGVMRIAESSTNVSELSRATASEAEDGTAAVTKNVEQMKAIDSSV
FT                   ENFGEVIQSLAHRSNEIGKIVDVINGIATQTNLLALNAAIEAARAGENGKGFAVVASEV
FT                   RKLAEQSQESTKQISHLIQNIKQETERSVFLMKEVSHHTKAGLETTEDSAVRFKQIMLR
FT                   TQEMTPRIEDVTATVEEIAANVQEVSASATEIAHIADENSAASERVAATTEEQLGSMED
FT                   ISQSAKTLSDMAEELQVLVSRFKI"
     MEQKKKRTLS IKQKLILTSM LLLLIPSLLI GFVSYSQAKQ KIMNEILQSA HAGVDRMNDE        60
     IMNIIDPMRR DVAFFADRID GTLYQSGKQN LDLKEKMTEY LDTHPQAANI YYATTSGEMT       120
     IYPEQSMPDD YDPRERPWYK AAEDASGKVV ITDPYVDAAS GKMMVTLSQT GGNGRGVIAI       180
     DVDVDRIADI AKKIKIGKEG YVTILDSKKN FVTHPTLKPG ETATGNWVGP LYAGKEGRFS       240
     YLFEDEDKQM DFMTNGLTGW KVAGTLYDRE ITDETASILW TTLGVIAGTF LLAGLLLFFI       300
     LRSIISPLNR LTKSAERIQE GDLTEEVVVE SNDEIGKVAE SFNTMILSLR GIISNLDQSI       360
     GQVAASSEEL MANAAQTTAA SEQIAGSIQE MAAGAGQSKR QLDGNAVSLQ AITSGVMRIA       420
     ESSTNVSELS RATASEAEDG TAAVTKNVEQ MKAIDSSVEN FGEVIQSLAH RSNEIGKIVD       480
     VINGIATQTN LLALNAAIEA ARAGENGKGF AVVASEVRKL AEQSQESTKQ ISHLIQNIKQ       540
     ETERSVFLMK EVSHHTKAGL ETTEDSAVRF KQIMLRTQEM TPRIEDVTAT VEEIAANVQE       600
     VSASATEIAH IADENSAASE RVAATTEEQL GSMEDISQSA KTLSDMAEEL QVLVSRFKI        659
//

If you have problems or comments...

PBIL Back to PBIL home page