(data stored in ACNUC7421 zone)

EMBL: CP001022.PE222

CP001022.PE222       Location/Qualifiers
FT   CDS             241359..242552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0224"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmr:Mmar10_1086 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59710"
FT                   /db_xref="GOA:B1YHS6"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS6"
FT                   /protein_id="ACB59710.1"
FT                   /translation="MARQTKLMEWQQAGLIDAETVDRIKAYEGHRQKKKRVPLLLIVGL
FT                   TFVGLALLSFLAANWQAIPALIKIGLVLVIMVSCYVLADVSERRTIWNPVAFRILGLVA
FT                   FAGALIVTVQSFHMSMQGSFIGWAVFLAALAHFFTWRHPAYAIVAFISGLNIFTGVGGF
FT                   GTEHATFLDWTSIVLVVIVSLAWFYFSQSFPSLILSWLFLYLSGLELFALVSYDGVLWP
FT                   IWTLFVLVPLLLVVKQDSDRHFLYHLYLIVAAINSLVYLTVRAETTDSVIPLGEAVALA
FT                   VFGLAIGYLIYQKFRPLLWILPLGLFGFLWLDEQAILIAALVEIIAFVYLIVQERQGRR
FT                   LTIPFVYFIAVQLTIYFIYAWDRLDMSLFFLVGALLVFLIAGVLWWIRKRHEGGVPS"
     MARQTKLMEW QQAGLIDAET VDRIKAYEGH RQKKKRVPLL LIVGLTFVGL ALLSFLAANW        60
     QAIPALIKIG LVLVIMVSCY VLADVSERRT IWNPVAFRIL GLVAFAGALI VTVQSFHMSM       120
     QGSFIGWAVF LAALAHFFTW RHPAYAIVAF ISGLNIFTGV GGFGTEHATF LDWTSIVLVV       180
     IVSLAWFYFS QSFPSLILSW LFLYLSGLEL FALVSYDGVL WPIWTLFVLV PLLLVVKQDS       240
     DRHFLYHLYL IVAAINSLVY LTVRAETTDS VIPLGEAVAL AVFGLAIGYL IYQKFRPLLW       300
     ILPLGLFGFL WLDEQAILIA ALVEIIAFVY LIVQERQGRR LTIPFVYFIA VQLTIYFIYA       360
     WDRLDMSLFF LVGALLVFLI AGVLWWIRKR HEGGVPS                                397
//

If you have problems or comments...

PBIL Back to PBIL home page