(data stored in ACNUC7421 zone)

EMBL: CP001022.PE224

CP001022.PE224       Location/Qualifiers
FT   CDS             complement(243455..245248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0226"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   bpu:BPUM_2525 carbon starvation-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59712"
FT                   /db_xref="GOA:B1YHS8"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS8"
FT                   /protein_id="ACB59712.1"
FT                   /translation="MSATPIVIAVICILLIVYRLYGTFMAVKVLKIKEDRETPAHKFAD
FT                   GKDYVPTNKWVSFGHHFAAIAAAGPLVGPVLAAQFGYLPGLLWLLIGAVIGGAVHDMVV
FT                   LFASMRQDGQSLSEVAKKELGPVAGFCAGLAMLFIITITMAGLSMVVLHALEHNPWGTF
FT                   AVFSTIPIAMGVGIYLRKGGNLALASVVGFLLILAAIGFGPQLTDTFIGTWFDLSSRQL
FT                   AIALPIYAFFAAALPVWLLLAPRDYLSSFMKIGVFFALIVGVFIINPDIRFPAFTKFVN
FT                   GGGPIIAGPVWPFISITIACGAISGFHAFVGSGTTPKMINRWSDIKPVAFGAMLVECLV
FT                   AVMALIAATSLEVGDYFAINSTPEVFATLGMSTVYLDELSREIGLDLAGRTGGAVSLAV
FT                   GMTFIFRAIPWFREIAGFFFQFVILFEAVFILTAIDAGTRVARYLIQDFFGEFYKPLKR
FT                   VDWIPGAIFASALGTFFWGYLLFSGDIGSIWALFGVSNQLMASIGLIIGTTIILKIADK
FT                   KVYALTTFIPLVYLLVTVTFADIWMVANVYANPASAGFSILNTILSFTMGILAIVITIS
FT                   AVRKWIELLNSPRWEKVKKSA"
     MSATPIVIAV ICILLIVYRL YGTFMAVKVL KIKEDRETPA HKFADGKDYV PTNKWVSFGH        60
     HFAAIAAAGP LVGPVLAAQF GYLPGLLWLL IGAVIGGAVH DMVVLFASMR QDGQSLSEVA       120
     KKELGPVAGF CAGLAMLFII TITMAGLSMV VLHALEHNPW GTFAVFSTIP IAMGVGIYLR       180
     KGGNLALASV VGFLLILAAI GFGPQLTDTF IGTWFDLSSR QLAIALPIYA FFAAALPVWL       240
     LLAPRDYLSS FMKIGVFFAL IVGVFIINPD IRFPAFTKFV NGGGPIIAGP VWPFISITIA       300
     CGAISGFHAF VGSGTTPKMI NRWSDIKPVA FGAMLVECLV AVMALIAATS LEVGDYFAIN       360
     STPEVFATLG MSTVYLDELS REIGLDLAGR TGGAVSLAVG MTFIFRAIPW FREIAGFFFQ       420
     FVILFEAVFI LTAIDAGTRV ARYLIQDFFG EFYKPLKRVD WIPGAIFASA LGTFFWGYLL       480
     FSGDIGSIWA LFGVSNQLMA SIGLIIGTTI ILKIADKKVY ALTTFIPLVY LLVTVTFADI       540
     WMVANVYANP ASAGFSILNT ILSFTMGILA IVITISAVRK WIELLNSPRW EKVKKSA          597
//

If you have problems or comments...

PBIL Back to PBIL home page