(data stored in ACNUC7421 zone)

EMBL: CP001022.PE229

CP001022.PE229       Location/Qualifiers
FT   CDS             250153..250908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0231"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bwe:BcerKBAB4_1224 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59717"
FT                   /db_xref="GOA:B1YHT3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT3"
FT                   /protein_id="ACB59717.1"
FT                   /translation="MDIGLITQYATVGLVLIILQGLLSADNAMVMAVLVRPLPDDQRKK
FT                   ALFYGLIGALVLRFVAIFFASYLATIWELQALGAIYLFYVAFKGIVEARSNKHQIPESA
FT                   SAKKASPNFWWTVVKVEFSDLAFAVDSTLAAVAMATTLPMIGGTIGGLNTGQFWVVFFS
FT                   GIIGLVIMRYFASWFVVLLQKRPGIEEAAFWLVAWVGVKLVVMTLAHPSIHVLPHEFPE
FT                   STLWQTIFWVVLALILVLGWFRSGPKTDK"
     MDIGLITQYA TVGLVLIILQ GLLSADNAMV MAVLVRPLPD DQRKKALFYG LIGALVLRFV        60
     AIFFASYLAT IWELQALGAI YLFYVAFKGI VEARSNKHQI PESASAKKAS PNFWWTVVKV       120
     EFSDLAFAVD STLAAVAMAT TLPMIGGTIG GLNTGQFWVV FFSGIIGLVI MRYFASWFVV       180
     LLQKRPGIEE AAFWLVAWVG VKLVVMTLAH PSIHVLPHEF PESTLWQTIF WVVLALILVL       240
     GWFRSGPKTD K                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page