(data stored in ACNUC7421 zone)

EMBL: CP001022.PE235

CP001022.PE235       Location/Qualifiers
FT   CDS             complement(255889..256737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0237"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: bld:BLi01197 YitS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59723"
FT                   /db_xref="GOA:B1YHT9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT9"
FT                   /protein_id="ACB59723.1"
FT                   /translation="MVRFITDSGADAPKELLDAYGFTVMPFGVLIDEETFFDGESISPV
FT                   ELYEKMRNGAAPKTFQVEVSRMVEVFTEHFKQGEPFLYLAFSSELSGTYQTATMLAAEL
FT                   AETYPDVPYAIINTKTASTGQGLFVLDVAEFSKTHNFEETKAYAEQKVNTIRHLFTVES
FT                   LEYLMRGGRVSRASAFIGGLLSILPLLTVEDGKLIPKEKIRGQKKVMNRIVEWMEEARP
FT                   SIDGHRIIIGHGDSIERAEQLKQLIEAQFSPSEVLITIAGAAIGSHTGPGLIVIGYDLP
FT                   A"
     MVRFITDSGA DAPKELLDAY GFTVMPFGVL IDEETFFDGE SISPVELYEK MRNGAAPKTF        60
     QVEVSRMVEV FTEHFKQGEP FLYLAFSSEL SGTYQTATML AAELAETYPD VPYAIINTKT       120
     ASTGQGLFVL DVAEFSKTHN FEETKAYAEQ KVNTIRHLFT VESLEYLMRG GRVSRASAFI       180
     GGLLSILPLL TVEDGKLIPK EKIRGQKKVM NRIVEWMEEA RPSIDGHRII IGHGDSIERA       240
     EQLKQLIEAQ FSPSEVLITI AGAAIGSHTG PGLIVIGYDL PA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page