(data stored in ACNUC7421 zone)

EMBL: CP001022.PE236

CP001022.PE236       Location/Qualifiers
FT   CDS             complement(256755..257576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0238"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bce:BC5386 lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59724"
FT                   /db_xref="GOA:B1YHU0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024897"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHU0"
FT                   /protein_id="ACB59724.1"
FT                   /translation="MGIELLKQEHYRIFDQTSLGNTFHATQSFAMDDTLCASVATEGAA
FT                   IRSWVHHETVVLGIQDARLPHLDDGIDVLHAHGFQPVIRNSGGLAVVLDAGVLNISLVL
FT                   PERGGIDIDSGYEAMLALVRRMFAEETDAINAGEVVGSYCPGSYDLSIAGKKFAGISQR
FT                   RVRGGVAVQIYLCVNGSGSARAQLVRDFYAAALQGETTKFVYPTVVPETMASLEELLQR
FT                   PLTVEDCLVRVYRSLMELGATLTPSVLSEVENERFGVNLGRMLDRNEKVLG"
     MGIELLKQEH YRIFDQTSLG NTFHATQSFA MDDTLCASVA TEGAAIRSWV HHETVVLGIQ        60
     DARLPHLDDG IDVLHAHGFQ PVIRNSGGLA VVLDAGVLNI SLVLPERGGI DIDSGYEAML       120
     ALVRRMFAEE TDAINAGEVV GSYCPGSYDL SIAGKKFAGI SQRRVRGGVA VQIYLCVNGS       180
     GSARAQLVRD FYAAALQGET TKFVYPTVVP ETMASLEELL QRPLTVEDCL VRVYRSLMEL       240
     GATLTPSVLS EVENERFGVN LGRMLDRNEK VLG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page