(data stored in ACNUC7421 zone)

EMBL: CP001022.PE239

CP001022.PE239       Location/Qualifiers
FT   CDS             260009..261187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0241"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: bcz:BCZK0517
FT                   nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59727"
FT                   /db_xref="GOA:B1YHU3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU3"
FT                   /protein_id="ACB59727.1"
FT                   /translation="MKYLIAILGLVIVFGLAYLVSSNRKSIKLKPLAVMLVLQLVLGYI
FT                   LLNTSFGYVVIKGVAQVFEKLLSYAAIGINFVFGGLANEGAQPFFINVLLPIVFISALI
FT                   GILQFTKILPLLMRGIGLVLSKINGMGQLESYNAVASAAIGQSEVFITVKKQIGKLPPH
FT                   RLYTLCASAMSTVSMSIVGAYMTMVEPKYVVTAIVLNLFGGFMIVSIINPYTVDPKEDI
FT                   LEIVEEKQTFFEMLGEYILDGFKVAIIVGAMLIGYNALIGMVNDIFLMVLGISFQDILG
FT                   YIFAPFAFIMGIPWAEAVSAGSIMATKLITNEFVAMLSLPEYAKEFSARTLGIVSVFLI
FT                   SFANFSSIGIIAGAVKGLDDRQGSVAASFGLKLLYGATLVSVLTSIVVSILL"
     MKYLIAILGL VIVFGLAYLV SSNRKSIKLK PLAVMLVLQL VLGYILLNTS FGYVVIKGVA        60
     QVFEKLLSYA AIGINFVFGG LANEGAQPFF INVLLPIVFI SALIGILQFT KILPLLMRGI       120
     GLVLSKINGM GQLESYNAVA SAAIGQSEVF ITVKKQIGKL PPHRLYTLCA SAMSTVSMSI       180
     VGAYMTMVEP KYVVTAIVLN LFGGFMIVSI INPYTVDPKE DILEIVEEKQ TFFEMLGEYI       240
     LDGFKVAIIV GAMLIGYNAL IGMVNDIFLM VLGISFQDIL GYIFAPFAFI MGIPWAEAVS       300
     AGSIMATKLI TNEFVAMLSL PEYAKEFSAR TLGIVSVFLI SFANFSSIGI IAGAVKGLDD       360
     RQGSVAASFG LKLLYGATLV SVLTSIVVSI LL                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page