(data stored in ACNUC7421 zone)

EMBL: CP001022.PE24

CP001022.PE24        Location/Qualifiers
FT   CDS             43157..44149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0025"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0044 DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59512"
FT                   /db_xref="GOA:B1YGD5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD5"
FT                   /protein_id="ACB59512.1"
FT                   /translation="MQTFHELEQTQSVIATILRNSLQTNRINHAYIFTGDYEPLLLEAA
FT                   QLFAKSLFCERRDQIEPCQTCRSCRRMDSGNLVDYYQIEPDGATIKKEQIQELMHDLSL
FT                   RGLEGDRQIYVVTQSHKMTPQAANSLLKFFEEPGAGKVAILITNQPQLLLPTIRSRGQL
FT                   LSFRPADRLLIGQVLSEKTGRDNELTQLAARVYPKIEDAEQALVEDWFVNARVSVLQLM
FT                   EELANRPADLPLFVQEKWMSQFKNRQDARIGLELVTCFFEDVLHLKLNPSWETITYANS
FT                   RPLLEQMGGKSQTTITRWLQAVLAAVKRIEANVNPQLTVERLMFDLQKG"
     MQTFHELEQT QSVIATILRN SLQTNRINHA YIFTGDYEPL LLEAAQLFAK SLFCERRDQI        60
     EPCQTCRSCR RMDSGNLVDY YQIEPDGATI KKEQIQELMH DLSLRGLEGD RQIYVVTQSH       120
     KMTPQAANSL LKFFEEPGAG KVAILITNQP QLLLPTIRSR GQLLSFRPAD RLLIGQVLSE       180
     KTGRDNELTQ LAARVYPKIE DAEQALVEDW FVNARVSVLQ LMEELANRPA DLPLFVQEKW       240
     MSQFKNRQDA RIGLELVTCF FEDVLHLKLN PSWETITYAN SRPLLEQMGG KSQTTITRWL       300
     QAVLAAVKRI EANVNPQLTV ERLMFDLQKG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page