(data stored in ACNUC7421 zone)

EMBL: CP001022.PE240

CP001022.PE240       Location/Qualifiers
FT   CDS             complement(261274..261903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0242"
FT                   /product="TrkA-N domain protein"
FT                   /note="KEGG: bwe:BcerKBAB4_1908 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59728"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU4"
FT                   /protein_id="ACB59728.1"
FT                   /translation="MAKVSLLGATGRTGRPLLDLLLEKGHEVRVLVRSEKHGLPDHPHL
FT                   TVIKGDATDADNLERVIEGTTAVFSCLGTDQKQILSVAVPNLIIKMKEQQIERIVFVGT
FT                   AGILDASEEPGKYRFQSSESRRRSTIAAEDHLKAYLTLKDADVDYTIICPTQLVEEDAI
FT                   EDVLIESNRFTHETGPIPRINVARFAYEVYDEGLFHRERVGIASRG"
     MAKVSLLGAT GRTGRPLLDL LLEKGHEVRV LVRSEKHGLP DHPHLTVIKG DATDADNLER        60
     VIEGTTAVFS CLGTDQKQIL SVAVPNLIIK MKEQQIERIV FVGTAGILDA SEEPGKYRFQ       120
     SSESRRRSTI AAEDHLKAYL TLKDADVDYT IICPTQLVEE DAIEDVLIES NRFTHETGPI       180
     PRINVARFAY EVYDEGLFHR ERVGIASRG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page