(data stored in ACNUC7421 zone)

EMBL: CP001022.PE25

CP001022.PE25        Location/Qualifiers
FT   CDS             44156..44986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0026"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: bcy:Bcer98_0027
FT                   PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59513"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD6"
FT                   /protein_id="ACB59513.1"
FT                   /translation="MLEVVGVRFKEAGKIYYFAPGQESLSRGQSVIVETVRGIEYGEVV
FT                   IADKQMDEEDVVLPLKSILRVADDKDAMIVRENKMAAFDAHAVCVEKIREHKLDMKLVD
FT                   VEYTFDRNKVIFYFTAEGRVDFRELVKDLAAVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   VLCCSSFLGEFEPVSIKMAKDQNLSLNPTKISGVCGRLMCCLKYENDTYEEMRRDLPDY
FT                   GKRLTVPEGEGRVVGLNILDQIVQIELKDRSRVLTYSMEELLSVGAVKQKRPKE"
     MLEVVGVRFK EAGKIYYFAP GQESLSRGQS VIVETVRGIE YGEVVIADKQ MDEEDVVLPL        60
     KSILRVADDK DAMIVRENKM AAFDAHAVCV EKIREHKLDM KLVDVEYTFD RNKVIFYFTA       120
     EGRVDFRELV KDLAAVFRTR IELRQIGVRD EAKLLGGIGP CGRVLCCSSF LGEFEPVSIK       180
     MAKDQNLSLN PTKISGVCGR LMCCLKYEND TYEEMRRDLP DYGKRLTVPE GEGRVVGLNI       240
     LDQIVQIELK DRSRVLTYSM EELLSVGAVK QKRPKE                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page