(data stored in ACNUC7421 zone)

EMBL: CP001022.PE256

CP001022.PE256       Location/Qualifiers
FT   CDS             complement(275520..277652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0258"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: sae:NWMN_2457 cation-transporting
FT                   ATPase E1-E2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59744"
FT                   /db_xref="GOA:B1YHW0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW0"
FT                   /protein_id="ACB59744.1"
FT                   /translation="MSKTMELNIEGMTCAACSARIEKVLNRMDGVEATVNLPLETARIA
FT                   VPEEMDEQLILDKIKKIGYGATIKTTPHEQVQNRRMLYRFWIAAFLSLPLLLSMVSHIP
FT                   NSPVHLPWLMNPWFQFALATPVQFVIGAPFYVGAYKSLRSGSANMDVLVVLGTSAAYFY
FT                   SVAEMMIHPLMPNLYFETSAVLITLVLLGKVLEDRAKQQTTGAIKSLLSLQATDAVVLE
FT                   QGVERTVSLDQVQPGMQLIVKPGQKIPVDGIITTGDAYLDESMLTGEPLPAHKGTGDVV
FT                   IGGTLNTNGYLTIEATKVGQETMLAGIIRVVEQAQTEKAPIQRQADRISGIFVPIVVAI
FT                   ALVTLAVWWWTTGSFAEAIRPAIAVLVIACPCALGLATPTSIMVGTGKGAEHGVLFKGG
FT                   AQLESLQHVDAVVFDKTGTLTIGRPVVIETFGQEQALDFAAALEKKSEHPLAHAITEER
FT                   DVVFDIEHFTVDPGRGVRGSIMGHDVMVGSVRMMQEHGLSLPDWTSSGATVVYVTVNGI
FT                   IEAGYAIRDELKPTTKQVIQEIQQTKAVYLLTGDRREVALQLATELQIPHSHVFSDVLP
FT                   IEKADHIKTLQANGQRVAMVGDGINDAPALATANVGIALGSGTDVALEAADVTLLGHDL
FT                   QQVITAIRLSEQTMKNIRQNLFFALGYNAVGIPVACLGLLAPWVAGAAMAFSSVSVVTN
FT                   ALRLKRIPLSKGGNQS"
     MSKTMELNIE GMTCAACSAR IEKVLNRMDG VEATVNLPLE TARIAVPEEM DEQLILDKIK        60
     KIGYGATIKT TPHEQVQNRR MLYRFWIAAF LSLPLLLSMV SHIPNSPVHL PWLMNPWFQF       120
     ALATPVQFVI GAPFYVGAYK SLRSGSANMD VLVVLGTSAA YFYSVAEMMI HPLMPNLYFE       180
     TSAVLITLVL LGKVLEDRAK QQTTGAIKSL LSLQATDAVV LEQGVERTVS LDQVQPGMQL       240
     IVKPGQKIPV DGIITTGDAY LDESMLTGEP LPAHKGTGDV VIGGTLNTNG YLTIEATKVG       300
     QETMLAGIIR VVEQAQTEKA PIQRQADRIS GIFVPIVVAI ALVTLAVWWW TTGSFAEAIR       360
     PAIAVLVIAC PCALGLATPT SIMVGTGKGA EHGVLFKGGA QLESLQHVDA VVFDKTGTLT       420
     IGRPVVIETF GQEQALDFAA ALEKKSEHPL AHAITEERDV VFDIEHFTVD PGRGVRGSIM       480
     GHDVMVGSVR MMQEHGLSLP DWTSSGATVV YVTVNGIIEA GYAIRDELKP TTKQVIQEIQ       540
     QTKAVYLLTG DRREVALQLA TELQIPHSHV FSDVLPIEKA DHIKTLQANG QRVAMVGDGI       600
     NDAPALATAN VGIALGSGTD VALEAADVTL LGHDLQQVIT AIRLSEQTMK NIRQNLFFAL       660
     GYNAVGIPVA CLGLLAPWVA GAAMAFSSVS VVTNALRLKR IPLSKGGNQS                  710
//

If you have problems or comments...

PBIL Back to PBIL home page