(data stored in ACNUC7421 zone)

EMBL: CP001022.PE257

CP001022.PE257       Location/Qualifiers
FT   CDS             complement(277665..277961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0259"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   lin:lin1968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59745"
FT                   /db_xref="GOA:B1YHW1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW1"
FT                   /protein_id="ACB59745.1"
FT                   /translation="MTHDHPLVPRSPEEQDALMKRLKRIEGQVRGIANMVAEDRYCIDI
FT                   LTQTASIQAALRQVELQVIERHVKMCMHDAATGKQDTDVYVDELMAVIARLKK"
     MTHDHPLVPR SPEEQDALMK RLKRIEGQVR GIANMVAEDR YCIDILTQTA SIQAALRQVE        60
     LQVIERHVKM CMHDAATGKQ DTDVYVDELM AVIARLKK                                98
//

If you have problems or comments...

PBIL Back to PBIL home page