(data stored in ACNUC7421 zone)

EMBL: CP001022.PE263

CP001022.PE263       Location/Qualifiers
FT   CDS             283650..285350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0265"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: bcy:Bcer98_0354 alpha
FT                   amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59751"
FT                   /db_xref="GOA:B1YHW7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW7"
FT                   /protein_id="ACB59751.1"
FT                   /translation="MTQMIPRPETAQKTLTRAWWKEAVAYQIYPRSFYDANNDGIGDIP
FT                   GIIAKLDYLKDLGVDVLWICPMFKSPNDDNGYDISDYEDIMDEFGTMADFDLLMEEAHK
FT                   RDIKVLLDLVVNHTSDEHPWFLESRSSKDNDKRDWYIWKDAVNGGEPNNWESIFGGSAW
FT                   EYDEKTEQYFLHVFSRRQPDLNWRNKDMRQAVYTMINWWLDKGVDGFRIDAISHINKDQ
FT                   SYADLPNPLGMPHVPSFEMHMNVEGIHEYLEELKNETFSKYDIMTVGEANGVTPEEADL
FT                   WVGEENGKMNMVFQFEHMDLWRADAEKGVDVVKLKQVLTKWQKGLEETGWNALYLENHD
FT                   KVRSVSLWGDEGQYWKQSAKSLAMMYFFMQGTPFIYQGQEIGMTNVQFPDISDYDDVAT
FT                   KNMYNMQLASGKTHEEIMEVIWNSSRDNSRTPMQWTNEQNGGFSEQSPWFGVNPNFADI
FT                   NVAAQQADEDSILNFYKRMIQIRKMEETLIYGEYDLILPEDTKVYGYTRTLGNEQFLIV
FT                   TNLKDEVAEVDTDIILHSDNIMLANYETTYHEGTELTLQPFEARLYRVR"
     MTQMIPRPET AQKTLTRAWW KEAVAYQIYP RSFYDANNDG IGDIPGIIAK LDYLKDLGVD        60
     VLWICPMFKS PNDDNGYDIS DYEDIMDEFG TMADFDLLME EAHKRDIKVL LDLVVNHTSD       120
     EHPWFLESRS SKDNDKRDWY IWKDAVNGGE PNNWESIFGG SAWEYDEKTE QYFLHVFSRR       180
     QPDLNWRNKD MRQAVYTMIN WWLDKGVDGF RIDAISHINK DQSYADLPNP LGMPHVPSFE       240
     MHMNVEGIHE YLEELKNETF SKYDIMTVGE ANGVTPEEAD LWVGEENGKM NMVFQFEHMD       300
     LWRADAEKGV DVVKLKQVLT KWQKGLEETG WNALYLENHD KVRSVSLWGD EGQYWKQSAK       360
     SLAMMYFFMQ GTPFIYQGQE IGMTNVQFPD ISDYDDVATK NMYNMQLASG KTHEEIMEVI       420
     WNSSRDNSRT PMQWTNEQNG GFSEQSPWFG VNPNFADINV AAQQADEDSI LNFYKRMIQI       480
     RKMEETLIYG EYDLILPEDT KVYGYTRTLG NEQFLIVTNL KDEVAEVDTD IILHSDNIML       540
     ANYETTYHEG TELTLQPFEA RLYRVR                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page