(data stored in ACNUC7421 zone)

EMBL: CP001022.PE264

CP001022.PE264       Location/Qualifiers
FT   CDS             285371..285886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0266"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   gtn:GTNG_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59752"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW8"
FT                   /protein_id="ACB59752.1"
FT                   /translation="MPNPAFAVAKKEIKKMQDRRKSCTLDDEVIEVKPVRYPVRLRQVT
FT                   SIQDDAMRESVELEADGTLFETKDGFALKFMQEDEQPIDTTIKWSHDQVALNRKGPVSM
FT                   HHVFILGQKTKSGYESQFGQMVMETETATIEMTEQRMQFQYDLMMNHQPVGLYTIELTW
FT                   ERSETHGV"
     MPNPAFAVAK KEIKKMQDRR KSCTLDDEVI EVKPVRYPVR LRQVTSIQDD AMRESVELEA        60
     DGTLFETKDG FALKFMQEDE QPIDTTIKWS HDQVALNRKG PVSMHHVFIL GQKTKSGYES       120
     QFGQMVMETE TATIEMTEQR MQFQYDLMMN HQPVGLYTIE LTWERSETHG V                171
//

If you have problems or comments...

PBIL Back to PBIL home page