(data stored in ACNUC7421 zone)

EMBL: CP001022.PE267

CP001022.PE267       Location/Qualifiers
FT   CDS             286860..287903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0269"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_1562 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59755"
FT                   /db_xref="GOA:B1YHX1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX1"
FT                   /protein_id="ACB59755.1"
FT                   /translation="MKAVQVNGYGGVEQLEVVERPVPTPRAGEVLVEVKACGINNTEIW
FT                   MREGAYGTDDKSGWKPEGVQFPRVPGSDISGRIIEVGSGVDPSRVGQDVVLFPFTSSGA
FT                   DGTEHISEDMSFIGSEYDGGYAEYVVWPATLCYDMPLDDYVKSAVFSVSGLTAWHMNEQ
FT                   LQLQPGQTVLVTGASGGVGSLNVQIASRVFGATVIAVVGDMKIEQELKRLGAKYVVSYR
FT                   SDQLTEDILAVNSGPVDAVLDVVGDALFKTALVVLKNGGKFCISGSAGGQQTNLDFRML
FT                   YLKHLTFYGSVLGTRDEFGRMLEAIADGKLEPVIDRTFPLEEAAAAQSYFKETGKLGKI
FT                   VLILKAD"
     MKAVQVNGYG GVEQLEVVER PVPTPRAGEV LVEVKACGIN NTEIWMREGA YGTDDKSGWK        60
     PEGVQFPRVP GSDISGRIIE VGSGVDPSRV GQDVVLFPFT SSGADGTEHI SEDMSFIGSE       120
     YDGGYAEYVV WPATLCYDMP LDDYVKSAVF SVSGLTAWHM NEQLQLQPGQ TVLVTGASGG       180
     VGSLNVQIAS RVFGATVIAV VGDMKIEQEL KRLGAKYVVS YRSDQLTEDI LAVNSGPVDA       240
     VLDVVGDALF KTALVVLKNG GKFCISGSAG GQQTNLDFRM LYLKHLTFYG SVLGTRDEFG       300
     RMLEAIADGK LEPVIDRTFP LEEAAAAQSY FKETGKLGKI VLILKAD                     347
//

If you have problems or comments...

PBIL Back to PBIL home page