(data stored in ACNUC7421 zone)

EMBL: CP001022.PE269

CP001022.PE269       Location/Qualifiers
FT   CDS             288605..290737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0271"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bce:BC5345
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59757"
FT                   /db_xref="GOA:B1YHX3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX3"
FT                   /protein_id="ACB59757.1"
FT                   /translation="MGTFLLINWIAFLLVAGYAGYLFVTLVKSRYEAIRRGKKAEWTLT
FT                   NKERLNAVLVNVFGQKKLLKDKKSGTIHVMMFYGFLLVQFGAIDFIWKGLAVGQRFPHI
FT                   PLGPLYPIFTFFQEIVMLVILVAVVWGFYRRYVEKLVRLKRNFMAGLALIFIGGLMIAV
FT                   LFGNGFFLVYENHSTFGEPVASAIAFLFSWVPQQVAFGLFVFFWWAHLLFLLSFMVYIP
FT                   QGKHAHLIAGTANVWLGRTSKVGRLAPIDLSVMEEAEDDEAEFSFGVNRIEDFNQKQLV
FT                   DLYACVECGRCTNMCPASGTGKMLSPMDLIVKLRDHLNMKTAAITQKSPWAPAFAFEGS
FT                   QGNQIASLAAAGQMDVVPDSLIGNVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRR
FT                   HLVMMEGKMDPEMQRTMANIERQGNPWGMNRKERENWRKTREELVVPTAKEKKKAGEEF
FT                   EYLFWVGAMGSYDSRSQKIAMAFARILNEADISFAILGNDEKNSGDTPRRIGNEVLFQE
FT                   LAEANIKSFEKYDVKKIVTIDPHAYNTFKNEYPDFGLSPDVEVYHHTELLARLIDDQRI
FT                   KPVHEVSERVVYHDSCYLGRYNDIYDAPRYILEKIPGITLVETERNREKGMCCGAGGGM
FT                   MWQEEKVGARVNVARTEQLLTVQPSVIGSACPYCLTMLSDGTKAKEVDEQVATYDVVEL
FT                   LERSIVGTPMKEAVTN"
     MGTFLLINWI AFLLVAGYAG YLFVTLVKSR YEAIRRGKKA EWTLTNKERL NAVLVNVFGQ        60
     KKLLKDKKSG TIHVMMFYGF LLVQFGAIDF IWKGLAVGQR FPHIPLGPLY PIFTFFQEIV       120
     MLVILVAVVW GFYRRYVEKL VRLKRNFMAG LALIFIGGLM IAVLFGNGFF LVYENHSTFG       180
     EPVASAIAFL FSWVPQQVAF GLFVFFWWAH LLFLLSFMVY IPQGKHAHLI AGTANVWLGR       240
     TSKVGRLAPI DLSVMEEAED DEAEFSFGVN RIEDFNQKQL VDLYACVECG RCTNMCPASG       300
     TGKMLSPMDL IVKLRDHLNM KTAAITQKSP WAPAFAFEGS QGNQIASLAA AGQMDVVPDS       360
     LIGNVITEEE IWACTTCRNC EDQCPVMNEH VDKIIDLRRH LVMMEGKMDP EMQRTMANIE       420
     RQGNPWGMNR KERENWRKTR EELVVPTAKE KKKAGEEFEY LFWVGAMGSY DSRSQKIAMA       480
     FARILNEADI SFAILGNDEK NSGDTPRRIG NEVLFQELAE ANIKSFEKYD VKKIVTIDPH       540
     AYNTFKNEYP DFGLSPDVEV YHHTELLARL IDDQRIKPVH EVSERVVYHD SCYLGRYNDI       600
     YDAPRYILEK IPGITLVETE RNREKGMCCG AGGGMMWQEE KVGARVNVAR TEQLLTVQPS       660
     VIGSACPYCL TMLSDGTKAK EVDEQVATYD VVELLERSIV GTPMKEAVTN                  710
//

If you have problems or comments...

PBIL Back to PBIL home page