(data stored in ACNUC7421 zone)

EMBL: CP001022.PE270

CP001022.PE270       Location/Qualifiers
FT   CDS             290875..291273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0272"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: bca:BCE_3393
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59758"
FT                   /db_xref="GOA:B1YHX4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX4"
FT                   /protein_id="ACB59758.1"
FT                   /translation="MRIFGKALLKIGQVAEATGLSKRTIDYYTSLGLLTTERTPAGYRL
FT                   YTEDVVQHIQKIEYLKTQRLSLQEILAFFTEREVKTGDAIYQEVQQLQESVNGLEQRLL
FT                   QSTDYEKQEIRLELSQRLTLIASLIAQL"
     MRIFGKALLK IGQVAEATGL SKRTIDYYTS LGLLTTERTP AGYRLYTEDV VQHIQKIEYL        60
     KTQRLSLQEI LAFFTEREVK TGDAIYQEVQ QLQESVNGLE QRLLQSTDYE KQEIRLELSQ       120
     RLTLIASLIA QL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page