(data stored in ACNUC7421 zone)

EMBL: CP001022.PE272

CP001022.PE272       Location/Qualifiers
FT   CDS             292801..294483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0274"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; 5TM
FT                   Receptors of the LytS-YhcK type transmembrane region; KEGG:
FT                   bsu:BSU28930 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59760"
FT                   /db_xref="GOA:B1YHX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX6"
FT                   /protein_id="ACB59760.1"
FT                   /translation="MLEQIPFLLSRLGMLALLAFLLSQWRISRHLFQTSSRRSHRFILL
FT                   GVFVVSGILMNYAGIGLSTDETIDPLIGLAVSPEQWVIDTRLTIIVTSGLLGGPLIGGL
FT                   TGVLVGFHRYYLGAFGAESAWIIAVGTGLLSGLYSRQWRRKDGYSLLQPIGIVLTAVIL
FT                   DIGVALMLAPDQALVLELTRQAVFPMLFTNAVGISVFIAILRTQLKIENELFVRESARS
FT                   YRLLDAIRPLRKSGMTVDVARKIGSTILEETKINRVVLLGPDGILADVRTGHDTADLFQ
FT                   HQTILEWVETAAVYRSEDELTRQIISFHPLQVEGKKAGIVCWFPVHLFDDTMERTMEQL
FT                   VDLLARELVVHQEEQLNQFPNTSIKPILSPNYLLGIVDEIHQTADPDTPVKQQLGALRQ
FT                   LLTTARRLDMYPLREELLTLKSYLSLEGIRRHHPLTPAAVTIDLDIETAVEEHFVFPLL
FT                   VTQLVDNALRHAFPQSGPYHRIDVRAFQEETHWVLEVSDNGVGIPAEFLKRWEQDKKTQ
FT                   TSNLFLLRRALHRRYGEQAGCTIYSRPGGTRLKLTLPLTTDQM"
     MLEQIPFLLS RLGMLALLAF LLSQWRISRH LFQTSSRRSH RFILLGVFVV SGILMNYAGI        60
     GLSTDETIDP LIGLAVSPEQ WVIDTRLTII VTSGLLGGPL IGGLTGVLVG FHRYYLGAFG       120
     AESAWIIAVG TGLLSGLYSR QWRRKDGYSL LQPIGIVLTA VILDIGVALM LAPDQALVLE       180
     LTRQAVFPML FTNAVGISVF IAILRTQLKI ENELFVRESA RSYRLLDAIR PLRKSGMTVD       240
     VARKIGSTIL EETKINRVVL LGPDGILADV RTGHDTADLF QHQTILEWVE TAAVYRSEDE       300
     LTRQIISFHP LQVEGKKAGI VCWFPVHLFD DTMERTMEQL VDLLARELVV HQEEQLNQFP       360
     NTSIKPILSP NYLLGIVDEI HQTADPDTPV KQQLGALRQL LTTARRLDMY PLREELLTLK       420
     SYLSLEGIRR HHPLTPAAVT IDLDIETAVE EHFVFPLLVT QLVDNALRHA FPQSGPYHRI       480
     DVRAFQEETH WVLEVSDNGV GIPAEFLKRW EQDKKTQTSN LFLLRRALHR RYGEQAGCTI       540
     YSRPGGTRLK LTLPLTTDQM                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page