(data stored in ACNUC7421 zone)

EMBL: CP001022.PE274

CP001022.PE274       Location/Qualifiers
FT   CDS             295686..296540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0276"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: lsl:LSL_0875 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59762"
FT                   /db_xref="GOA:B1YHX8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX8"
FT                   /protein_id="ACB59762.1"
FT                   /translation="MTKIAWVTDSMAYFKKEEAEAIGVNVVPIQILLGETAYNEDTITV
FT                   ERLFRALEADKKLVAKTSQPIFGEFVGTYERLKEEGYDCAIAVHCTNGLSSTVQSSASA
FT                   AEAASFPVHIIDSHTAFENQQEFIRIGMALEAEGKSVEEITAALHALAKKTHFYMIVGN
FT                   METMRRGGRVSSGDLFLANLLSIKPIITTDEAGKIVPFKKARSLKKAYIEIIKQVEEAM
FT                   RQHTFYKNRIYVATTMAPEMAADLRTQVAAKFPELTVLDGTFGPAIGTHAGAETVGLFW
FT                   LND"
     MTKIAWVTDS MAYFKKEEAE AIGVNVVPIQ ILLGETAYNE DTITVERLFR ALEADKKLVA        60
     KTSQPIFGEF VGTYERLKEE GYDCAIAVHC TNGLSSTVQS SASAAEAASF PVHIIDSHTA       120
     FENQQEFIRI GMALEAEGKS VEEITAALHA LAKKTHFYMI VGNMETMRRG GRVSSGDLFL       180
     ANLLSIKPII TTDEAGKIVP FKKARSLKKA YIEIIKQVEE AMRQHTFYKN RIYVATTMAP       240
     EMAADLRTQV AAKFPELTVL DGTFGPAIGT HAGAETVGLF WLND                        284
//

If you have problems or comments...

PBIL Back to PBIL home page