(data stored in ACNUC7421 zone)

EMBL: CP001022.PE278

CP001022.PE278       Location/Qualifiers
FT   CDS             299075..300004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0280"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bat:BAS3184 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59766"
FT                   /db_xref="GOA:B1YHY2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY2"
FT                   /protein_id="ACB59766.1"
FT                   /translation="MKAAYIEQYGGSEQFKVGELDRPIVGADDVLIAVHAASVNPVDWK
FT                   LREGYLKEMLSYDMPLVIGWDVSGVIEEVGENVTDLKVGDEVFSRPDIARQGTYAEYVA
FT                   VDAHLVVKKPEALTFEEAASLPLVAHTAWQVMFEVMDAKAGDKIFIGAGSGGVGTVAIQ
FT                   LAKAHGLHVITSTSTKNVDWVKALGADEVIDYKQEDPADRVRDLDFVFDTMGGDGQAKL
FT                   YQMLKPNGMLVSISTPPDEDQAKEAQARVAYVFMQPTGERLQHIAQAVERGELKPVVDR
FT                   IFDLDQIKEAHDYGEEGHAKGKIVIKVK"
     MKAAYIEQYG GSEQFKVGEL DRPIVGADDV LIAVHAASVN PVDWKLREGY LKEMLSYDMP        60
     LVIGWDVSGV IEEVGENVTD LKVGDEVFSR PDIARQGTYA EYVAVDAHLV VKKPEALTFE       120
     EAASLPLVAH TAWQVMFEVM DAKAGDKIFI GAGSGGVGTV AIQLAKAHGL HVITSTSTKN       180
     VDWVKALGAD EVIDYKQEDP ADRVRDLDFV FDTMGGDGQA KLYQMLKPNG MLVSISTPPD       240
     EDQAKEAQAR VAYVFMQPTG ERLQHIAQAV ERGELKPVVD RIFDLDQIKE AHDYGEEGHA       300
     KGKIVIKVK                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page