(data stored in ACNUC7421 zone)

EMBL: CP001022.PE280

CP001022.PE280       Location/Qualifiers
FT   CDS             complement(301129..301509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0282"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bcl:ABC0784
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59768"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY4"
FT                   /protein_id="ACB59768.1"
FT                   /translation="MEETPSCRVETALEILTGKWKPSILLELITHDTLRFSELKRNLPN
FT                   ITQKMLTAQLRELELNDIVHREIYQVVPPRVEYSLTDYGKTLIPVLNAINAWGEKHVEH
FT                   LAQKDMLQDTTPTLASSTSDSF"
     MEETPSCRVE TALEILTGKW KPSILLELIT HDTLRFSELK RNLPNITQKM LTAQLRELEL        60
     NDIVHREIYQ VVPPRVEYSL TDYGKTLIPV LNAINAWGEK HVEHLAQKDM LQDTTPTLAS       120
     STSDSF                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page