(data stored in ACNUC7421 zone)

EMBL: CP001022.PE281

CP001022.PE281       Location/Qualifiers
FT   CDS             301630..302484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0283"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bld:BLi00862 YfiE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59769"
FT                   /db_xref="GOA:B1YHY5"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY5"
FT                   /protein_id="ACB59769.1"
FT                   /translation="MNINPNITLGPVSLRITNLEQSIAFYRDALGLTVLRQDEQTATLG
FT                   AKTTPLVILEQHSTAKQLPKNSVAGLYHFAILLPNRKELGFVIRNLIAQGIELGQGDHL
FT                   VSEAFYLSDPDGNGIEIYADRPRDTWTYEANGDVKMTTDPVDWQSMLVEAGEEDWYGMP
FT                   AETVMGHVHFHVKSLEAARKFYVETLGFDVAADASRMRALFLAAGGYHHHIGTNVWSGV
FT                   DAPKTPADAVGLKYWTLIYPDAASRETAVAALEQSPYEVNRQEDAVYVTDDAGITARLL
FT                   SKG"
     MNINPNITLG PVSLRITNLE QSIAFYRDAL GLTVLRQDEQ TATLGAKTTP LVILEQHSTA        60
     KQLPKNSVAG LYHFAILLPN RKELGFVIRN LIAQGIELGQ GDHLVSEAFY LSDPDGNGIE       120
     IYADRPRDTW TYEANGDVKM TTDPVDWQSM LVEAGEEDWY GMPAETVMGH VHFHVKSLEA       180
     ARKFYVETLG FDVAADASRM RALFLAAGGY HHHIGTNVWS GVDAPKTPAD AVGLKYWTLI       240
     YPDAASRETA VAALEQSPYE VNRQEDAVYV TDDAGITARL LSKG                        284
//

If you have problems or comments...

PBIL Back to PBIL home page