(data stored in ACNUC7421 zone)

EMBL: CP001022.PE286

CP001022.PE286       Location/Qualifiers
FT   CDS             307458..307943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59774"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ0"
FT                   /protein_id="ACB59774.1"
FT                   /translation="MRKSIQGLLVSGLIVTSTGLAGCSVTSDAAEHYAVSAPLSVKFEI
FT                   PKVLKADQEKQYRFGATLWQDQKAVKEAEYVHFEIWKADGTLRYSMEPADETKPGVYSI
FT                   EKKLPKEGLYYIKVHASSNGAMIMPTRQFIVGELSANDLKILQGGAKPAGGSSGHHH"
     MRKSIQGLLV SGLIVTSTGL AGCSVTSDAA EHYAVSAPLS VKFEIPKVLK ADQEKQYRFG        60
     ATLWQDQKAV KEAEYVHFEI WKADGTLRYS MEPADETKPG VYSIEKKLPK EGLYYIKVHA       120
     SSNGAMIMPT RQFIVGELSA NDLKILQGGA KPAGGSSGHH H                           161
//

If you have problems or comments...

PBIL Back to PBIL home page