(data stored in ACNUC7421 zone)

EMBL: CP001022.PE287

CP001022.PE287       Location/Qualifiers
FT   CDS             308136..308333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59775"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ1"
FT                   /protein_id="ACB59775.1"
FT                   /translation="MKMKKSYLAVPLSAALLIPAAGVSAHGHEDHSKMSHSSGKVSLDF
FT                   SSPASDLRATLDQLLSEHAY"
     MKMKKSYLAV PLSAALLIPA AGVSAHGHED HSKMSHSSGK VSLDFSSPAS DLRATLDQLL        60
     SEHAY                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page