(data stored in ACNUC7421 zone)

EMBL: CP001022.PE288

CP001022.PE288       Location/Qualifiers
FT   CDS             complement(308572..310362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0290"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: lwe:lwe1306
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59776"
FT                   /db_xref="GOA:B1YHZ2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ2"
FT                   /protein_id="ACB59776.1"
FT                   /translation="MKSFNRSTTYMPGLDGLRAFAVIAVILYHLSVPMLTGGFLGVDVF
FT                   FVLSGYLITGLLLSEWQQTGRIDLKRFWVHRFRRLFPPLFVLLVLVLSYVTVFERDLLH
FT                   MLRQDIMAALVYMTNWWYIVHDVSYFESFGKPSPIQNLWSLAIEEQFYLIFPIVLSFGL
FT                   ASKRLLLRGIALLALLSALLMAILFTPGMDPSRVYYGTDTRLFALLIGSLLAFAWRPER
FT                   FKKEIPSRGVRLLNVTGAVIVPVLVVLMLVTSEYGRFLYYGGFVFVAVLAALLIAVVAH
FT                   PASFWSRLFAAQWLIAIGKRSYGLYLWHFPLITLMTPIEQTGTFSWLRNLGILVILVIV
FT                   TELSYQFVERPVRRLGLLGYIRQFQIHPRTFRQFSRTKWVSVSLASLLLLSFIGNLSIL
FT                   AVSDEPAQQSIPTVAAPHSKPVLVKKPTNPVPEKRTRSMCRPTLAIGDSVLLGVEDYLG
FT                   SKLQQVTIDAKLGRQLREAIPLSTKYAAYNHTDHQVILHLGTNGSFRPEQLEELLDRFA
FT                   NADQVYLVTTRVPRPWEREVNTMLKQAAERKRVTLIDWHAVAVKHPSYFEQDGVHLNIK
FT                   GARAYSKLLAKATGCAPTTK"
     MKSFNRSTTY MPGLDGLRAF AVIAVILYHL SVPMLTGGFL GVDVFFVLSG YLITGLLLSE        60
     WQQTGRIDLK RFWVHRFRRL FPPLFVLLVL VLSYVTVFER DLLHMLRQDI MAALVYMTNW       120
     WYIVHDVSYF ESFGKPSPIQ NLWSLAIEEQ FYLIFPIVLS FGLASKRLLL RGIALLALLS       180
     ALLMAILFTP GMDPSRVYYG TDTRLFALLI GSLLAFAWRP ERFKKEIPSR GVRLLNVTGA       240
     VIVPVLVVLM LVTSEYGRFL YYGGFVFVAV LAALLIAVVA HPASFWSRLF AAQWLIAIGK       300
     RSYGLYLWHF PLITLMTPIE QTGTFSWLRN LGILVILVIV TELSYQFVER PVRRLGLLGY       360
     IRQFQIHPRT FRQFSRTKWV SVSLASLLLL SFIGNLSILA VSDEPAQQSI PTVAAPHSKP       420
     VLVKKPTNPV PEKRTRSMCR PTLAIGDSVL LGVEDYLGSK LQQVTIDAKL GRQLREAIPL       480
     STKYAAYNHT DHQVILHLGT NGSFRPEQLE ELLDRFANAD QVYLVTTRVP RPWEREVNTM       540
     LKQAAERKRV TLIDWHAVAV KHPSYFEQDG VHLNIKGARA YSKLLAKATG CAPTTK           596
//

If you have problems or comments...

PBIL Back to PBIL home page