(data stored in ACNUC7421 zone)

EMBL: CP001022.PE289

CP001022.PE289       Location/Qualifiers
FT   CDS             complement(310499..311065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0291"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ent:Ent638_3817 osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59777"
FT                   /db_xref="GOA:B1YHZ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ3"
FT                   /protein_id="ACB59777.1"
FT                   /translation="MFDFLKEAIQSPKTIGAIAPSSPRLAQMMAQRAVADHPDVIIEVG
FT                   AGDGAITQALLRARHPETTYRYAGPAHLSVQAAPNLLRRLIENLVRNATLHGTGDLSFE
FT                   VLQESGHLTFRCSNAIPETLTPHQLTELATPFVTSDMSRSNGGSGIGLSIIEQIVARHN
FT                   GTMQLTSEQNRFIVSVVLPDAYKEG"
     MFDFLKEAIQ SPKTIGAIAP SSPRLAQMMA QRAVADHPDV IIEVGAGDGA ITQALLRARH        60
     PETTYRYAGP AHLSVQAAPN LLRRLIENLV RNATLHGTGD LSFEVLQESG HLTFRCSNAI       120
     PETLTPHQLT ELATPFVTSD MSRSNGGSGI GLSIIEQIVA RHNGTMQLTS EQNRFIVSVV       180
     LPDAYKEG                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page