(data stored in ACNUC7421 zone)

EMBL: CP001022.PE290

CP001022.PE290       Location/Qualifiers
FT   CDS             311231..312286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0292"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: cbd:COXBU7E912_0849 metal binding domain of
FT                   Ada/methylated-DNA-[protein]-cysteine S-methyltransferase;
FT                   TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   methylguanine DNA methyltransferase ribonuclease domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; SMART: helix-turn-helix-
FT                   domain containing protein AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59778"
FT                   /db_xref="GOA:B1YHZ4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ4"
FT                   /protein_id="ACB59778.1"
FT                   /translation="MMNTLPETDYYEALVRRDGSYEGTFFVGVKTTGIFCRPTCPARKP
FT                   KQENCEFFETAKEALLASYRPCLRCKPLAYPGDSEVITRLIAAVEANPEKRFKDADFRE
FT                   LGLDASTARRQFKKRFGMTFVEYARSRRMGLAMKEIRKGQPVIEVQLASGYESSSGFRD
FT                   AFARILGETPKRWSGAYLQAKWLDTPLGPMLAIADEGGLHLLEFVDRRGLEREVERLRL
FT                   TARAVIIPGDAPVFEQVTVQLEEYFAGTRDRFDLPLVLYGTPFQRQVWEQLCLIPAGET
FT                   ISYQELAVRVGNPAAVRAVARANGANQLAILIPCHRVIRLAGDLGGYAGGLARKAALLK
FT                   LERTKRGLNHR"
     MMNTLPETDY YEALVRRDGS YEGTFFVGVK TTGIFCRPTC PARKPKQENC EFFETAKEAL        60
     LASYRPCLRC KPLAYPGDSE VITRLIAAVE ANPEKRFKDA DFRELGLDAS TARRQFKKRF       120
     GMTFVEYARS RRMGLAMKEI RKGQPVIEVQ LASGYESSSG FRDAFARILG ETPKRWSGAY       180
     LQAKWLDTPL GPMLAIADEG GLHLLEFVDR RGLEREVERL RLTARAVIIP GDAPVFEQVT       240
     VQLEEYFAGT RDRFDLPLVL YGTPFQRQVW EQLCLIPAGE TISYQELAVR VGNPAAVRAV       300
     ARANGANQLA ILIPCHRVIR LAGDLGGYAG GLARKAALLK LERTKRGLNH R                351
//

If you have problems or comments...

PBIL Back to PBIL home page