(data stored in ACNUC7421 zone)

EMBL: CP001022.PE291

CP001022.PE291       Location/Qualifiers
FT   CDS             312283..313338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU09810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59779"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ5"
FT                   /protein_id="ACB59779.1"
FT                   /translation="MSLIKDVFTDEWLDRLGKALNATDFRKTVQQEDWEELAFKQRVRR
FT                   IATRLEHHLPAEFEQAATRLETIAPDFPGLPGIVFPDYIEIQAEEGDWDRAMLALERLT
FT                   PHSTSEFAVRRFLLDDQDRFLEGATRWSQSSDEHVRRLASEGTRPRLPWGQMIPSLIAD
FT                   PRPVLPILDSLLEDDALYVRKSVANHLNDIAKTHPELVIERLERLGTHSHTDWILRHAS
FT                   RTLLKQGHRDVLKAFGLVTRGTVTVDELTVTPTLAIGGELAFSFHVTTTEPQVLRIEYA
FT                   IDYVKKRGTSQKVFRISERQVTGRETFAKRQSFRNLTTRVHYPGTHQVTILINGEAYAT
FT                   TEFDVTKEETT"
     MSLIKDVFTD EWLDRLGKAL NATDFRKTVQ QEDWEELAFK QRVRRIATRL EHHLPAEFEQ        60
     AATRLETIAP DFPGLPGIVF PDYIEIQAEE GDWDRAMLAL ERLTPHSTSE FAVRRFLLDD       120
     QDRFLEGATR WSQSSDEHVR RLASEGTRPR LPWGQMIPSL IADPRPVLPI LDSLLEDDAL       180
     YVRKSVANHL NDIAKTHPEL VIERLERLGT HSHTDWILRH ASRTLLKQGH RDVLKAFGLV       240
     TRGTVTVDEL TVTPTLAIGG ELAFSFHVTT TEPQVLRIEY AIDYVKKRGT SQKVFRISER       300
     QVTGRETFAK RQSFRNLTTR VHYPGTHQVT ILINGEAYAT TEFDVTKEET T                351
//

If you have problems or comments...

PBIL Back to PBIL home page