(data stored in ACNUC7421 zone)

EMBL: CP001022.PE297

CP001022.PE297       Location/Qualifiers
FT   CDS             315853..316938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0299"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bsu:BSU09120 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59785"
FT                   /db_xref="GOA:B1YI01"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI01"
FT                   /protein_id="ACB59785.1"
FT                   /translation="MLSQFNQFLLNFSLLITSLLFAFLPLRHVKLISPASPVKLRILIG
FT                   FIAGFISVLLVLNSITYDGAKIDLRLVALVTAYYYGGWVSGGITTLSILGARFAVTPPG
FT                   AYEGLILTGLICIALLITASIYRRFASHTLKDYLVLIGIGIGYSLPALYLLTETFNRFL
FT                   EIALVYIIFILLGGYVTYSFLQELRKHFQFVQTQQELALTDGLTNLANRRKLDETLASY
FT                   DKYGFAFSVLIVDIDFFKSVNDTYGHDGGDVVLRQLSHLLEHCCPDQALVGRYGGEEFV
FT                   VLLPDTPLKDAVRLGETIRLACADQHFVFSTYPAFHVTLSIGAASSDQGETSFEVIQKA
FT                   DQSLYQAKQTGRNKVVAYSEE"
     MLSQFNQFLL NFSLLITSLL FAFLPLRHVK LISPASPVKL RILIGFIAGF ISVLLVLNSI        60
     TYDGAKIDLR LVALVTAYYY GGWVSGGITT LSILGARFAV TPPGAYEGLI LTGLICIALL       120
     ITASIYRRFA SHTLKDYLVL IGIGIGYSLP ALYLLTETFN RFLEIALVYI IFILLGGYVT       180
     YSFLQELRKH FQFVQTQQEL ALTDGLTNLA NRRKLDETLA SYDKYGFAFS VLIVDIDFFK       240
     SVNDTYGHDG GDVVLRQLSH LLEHCCPDQA LVGRYGGEEF VVLLPDTPLK DAVRLGETIR       300
     LACADQHFVF STYPAFHVTL SIGAASSDQG ETSFEVIQKA DQSLYQAKQT GRNKVVAYSE       360
     E                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page