(data stored in ACNUC7421 zone)

EMBL: CP001022.PE30

CP001022.PE30        Location/Qualifiers
FT   CDS             complement(47273..47569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0031"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: bha:BH0050
FT                   transcriptional pleiotropic regulator of transition state
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59518"
FT                   /db_xref="GOA:B1YGE1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGE1"
FT                   /protein_id="ACB59518.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLQIAEKDALEIYVDNEQIIL
FT                   KKYKPNMTCQVTGEVSEDNFKLADGKLILSPDGAQRVLVELKDFLDRHYAGNE"
     MKSTGIVRKV DELGRVVIPI ELRRTLQIAE KDALEIYVDN EQIILKKYKP NMTCQVTGEV        60
     SEDNFKLADG KLILSPDGAQ RVLVELKDFL DRHYAGNE                                98
//

If you have problems or comments...

PBIL Back to PBIL home page